General Information

  • ID:  hor006453
  • Uniprot ID:  Q08535
  • Protein name:  Secretin
  • Gene name:  Sct
  • Organism:  Mus musculus (Mouse)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Highly expressed in the intestine .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0046659 digestive hormone activity
  • GO BP:  GO:0002024 diet induced thermogenesis; GO:0007165 signal transduction; GO:0007420 brain development; GO:0008542 visual learning; GO:0009992 intracellular water homeostasis; GO:0021542 dentate gyrus development; GO:0021766 hippocampus development; GO:0031667 response to nutrient levels; GO:0032098 regulation of appetite; GO:0043524 negative regulation of neuron apoptotic process; GO:0051402 neuron apoptotic process; GO:0097150 neuronal stem cell population maintenance
  • GO CC:  NA

Sequence Information

  • Sequence:  HSDGMFTSELSRLQDSARLQRLLQGLV
  • Length:  27(32-58)
  • Propeptide:  MEPPLPTPMLLLLLLLLSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDTENIPENSLARSKPLEDQLCLLWSNTQTLQDWLLPRLSLDGSLSLWLPPGPRSAVDRSEWTETTRPPR
  • Signal peptide:  MEPPLPTPMLLLLLLLLSSSAA
  • Modification:  T27 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:20578263, PubMed:20739612, PubMed:20927047, PubMed:30449620). Exerts its biological effects by binding to secretin rec
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Sctr
  • Target Unid:  Q5FWI2
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q08535-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006453_AF2.pdbhor006453_ESM.pdb

Physical Information

Mass: 352241 Formula: C130H217N41O42S
Absent amino acids: CIKNPWY Common amino acids: L
pI: 7.55 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 9
Hydrophobicity: -32.96 Boman Index: -6388
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 101.11
Instability Index: 7438.52 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8179583
  • Title:  cDNA sequence and genomic organization of mouse secretin.
  • PubMed ID:  18534766
  • Title:  Impaired hippocampal synaptic function in secretin deficient mice.
  • PubMed ID:  20578263
  • Title:  Knockout of secretin receptor reduces large cholangiocyte hyperplasia in mice with extrahepatic cholestasis induced by bile duct
  • PubMed ID:  21159798
  • Title:  
  • PubMed ID:  20739612
  • Title:  
  • PubMed ID:  20927047
  • Title:  
  • PubMed ID:  24273196
  • Title:  
  • PubMed ID:  30449620
  • Title: